該頁無縮略圖
Product Selection
Honesty,innovation,forgeahead,steadydevelopment
ELECTRONORTE,LIMITADA
EN
Specialistonlymasterhisownfield Thesameweare
Doreal securityheartofheart
Innovationwithunlimited future
From science and technology elements into the sea
of the world
People-oriented,honesty-based,excellence-orientedand innovation-orieted Beloyal,dedicatedandrealistic CustomerFirstandCredibleManagement Actions light uponeself,detailsdeterminequality Fighting forInnovation
Enterprise introduction
Electronorte,limitada isa large-scale electrical equipment manufacturing enterprise that integrates design,development,manufacturing，sales,and service. Main production and operation: European and American combination substations; Cable branch box; Complete set of high and low voltage switchgear equipment; Various products such as complete sets of low-voltage switch equipment.The product is widely used in fields such as power station substations,metallurgy,mining,oil fields,petrochemicals,thermal power,and residential areas.
The company always adheres to the responsibility of safeguarding electrical safety，winning the trust and support of customers with quality and service.The company has also passed the certification of quality management system,obtained the "National Compulsory Product Certification Certificate"issued by the China Quality Certification Center, and obtained the safety type test report from the national authoritative department. Combining market demand and constantly surpassing is our eternal pursuit goal.
The company adheres to the principle of "survival through quality and development through technology",and insists on the purpose of "customer first,service first,and reputation first"，providing users with safe and reliable products and satisfactory services,and making unremitting efforts to become a more trustworthy brand!
YB□33kV Environmentally-friendly modular substation 01-04
YB□-24kV(15kV) Smart/compact box substation 05-08
YBM Intelligent prefabricated substation 09-12
KYN61-40.5(Z) Armored removable AC metal enclosed switchgear 13-18
KYN28-24(15) Armored removable AC metal-enclosed switchgear 19-25
KYN28A-12(10-11kV) Armored removable AC metal-enclosed switchgear 26-30
XGN66-12 High voltage switchgear series 31-33
HXGN□-12 High voltage switchgear series 34-36
XGN□-12 Fully sealed fully insulated inflatable ring network switchgear 37-41
XGN□-40.5 Totally enclosed and fullyinsulated inflatable ring network switching equipment42-43
DFW-12/630 Outdoor intelligent box opening and closing 44-46
DFW10-12 Cable branch box 47-49
JHR-400 Low-voltage cable distribution box 51-51
MNSLowVoltageSwitchgearSeries 52-54
GGD AC low-voltage fixed switchgear 55-58
GGJ Low-voltage reactive power intelligent compensation device 59-61
GCK Low Voltage Switchgear Series 62-64
GCS Low Voltage Switchgear Series 65-66
GZDW DC power screen 68-70
JP Integrated distribution box (compensation\controlterminallighting) 71-75
SC(B)10/20/35kV Epoxy resin cast dry type transformer 76-79
S10 series 11kv class distribution transformer 80-82
S11 series 15/20kv class distribution transformer 83-84
S11 series 33kVclass oltc power transformer 85-86
ZN63(VS1)-12Fixed/Handcart Indoor High Voltage Vacuum Circuit Breaker 87-90
ZN85-40.5lndoor high-voltage vacuum circuit breaker 91-95
ZW32-12 Outdoor high-voltage vacuum circuit breaker (spring mechanism) 96-100
ZW32-12FGOutdoor high-voltage vacuum circuit breaker/intelligent type 101-103
ZW32-40.5Outdoor high-voltage vacuum circuit breaker 104-106
ZW43-12Outdoor high-voltage vacuum circuit breaker 107-109
ZW7-40.5/35kVOutdoor vacuum circuit breaker 110-113
Outdoor isolation switch 114-115
HV Drop Out Fuse Cutout 116-122
Zinc oxide lightning arrester 123-128
Detachable Type Surge (Lightning)Arrester 129-131
GW4Outdoor double-column horizontal opening high-voltage isolating switch 132-136
Environmentally-friendly modular substation
Respectingpromiseandkeepingpromise,operatingintherightway，strivingfor perfection,coexistenceandwin-winsituation
Overview
Combinedtypeoftransformersubstationisakindofcompletesetproductintegratingvoltageswitchequipmentandtransformer withLVdistribuoqipmentItissuallpdtivicrcitecuressdentialdistrictsidzdafactond oilfeldsusedastransformationanddistributionequipmentwithcharacterisicofstrongcompletenessandcompactstructure,igh reliabityo toadapttothesurroundingsandfriendlytotheenvironent,italltheideaofsuccessofurenturbanandruralcivigineing transformers substation.and alsois newtype complete set equipment forurban networkconstructionand reformation.
Modelandmeaning
YB □ □ □33/ □ RatedvoltageatLVside RatedvoltageatHVside Capacityof transformer Design number Company code Transformer substation
Useenvironmentalconditions
1. Altitude: <= 3 0 0 0 m
2.Ambient temperature: + 4 0 C - 2 5 C ：
3.Relative humidity:Dailyaverage <= 9 5 % ，monthlyaverage <= 9 0 % ：
4.Abnormal severe vibrationor impact;
5.Environment for installtion:Indoors,nofireorexplosiondanger,nocorrosivegasordust,nosharpimpact.
Note:Please negotiate with us if your product is used beyond the range of above conditions.
Structuralfeatures
1.Thistransformerismadeupofswitchcompartment,lowswitchcompartmentandrelayprotectioncompartmentandtransformer compartmentEnclosuresfHV,LVswitchcompartmentandrelayprotectioncompartmentcanbmadeofminumloyplateteel plateofcompositeplate.AluminumallyplateisananodizeoxidationtreatedtostrengthenitscorrosionstabilitySteekplateand stelstructuredpartsareallphosphatingtreatedandthecompositeplateisfaturedwithvividappearanceheatinsulationandfire retardation.Thetransformercompartmentisarangedwithsafeguardprotectingnetbutnotenclosure,whichnotonlyguaranteseer thermal diffusivity but also isable to insure personand equip ment against accident.
2.HVswitchcompartment:TheHVswitchcompartmentcanbemountedwithKYN61-33switchgearor33KVloadswitchAerialcable typesavailable formounting 33KVinlet wire.
3.LVswitch compartment
a.whenitis15Kvatowoltageside,theLVswitchcompartmentcanbemountedwithXGN2-415.KZN-15switchgearHG-F. HXGN26-(10F)Ring main unit
b.when it is 0 . 4 \mathsf { k v } atLVswitch compartment(no preparationofLVswitch gear inconsiderationof space saving)canbe series mounted withDW1sTseries,MEseriesandFframetypecircuitbreakeraswellasDZ2Oseries,CMseries,HseriesandSseriesmoldedcase air circuit breaker.
4.Powerofprotectionmpartment:tepoweoffprotectionompartmentisountedithCpanelCpanel,signalpanelotectio panel,motion control panel (RTU),carrier wave machine panel or optical fiber termination set.
Note:Thistransformersubstationcanadoptgeneralrelayprotection.alsomcrocomputerbused integratedautomaticcontrolsystemis available on request.
5Refer to the plan layoutand vertical plane layout of transformer of 33KV.
Plane,elevationlayout
| Model | Raledvoltage | Rated capacity | (kV/kV)Change |
| Sz7 | 33/36 | 400-20000 | 33/15,33/11,33/0.4 |
| Sz9 | 33/36 | 400-20000 | 33/15,33/11,33/0.4 |
Typicalone-timewiringdiagram
33kVsideone-linediagram
| Application | 1#incoming | 1#PT | incomigg | Standby | capacitance | Breaking | 2#PT | capaciance | Outgoing | Outgoing | 6#spare | outoing | |
| Cabinet type | XCN66 | XCN66 | XGN66 | XGN66 | XGN66 | XGN66 | XGN66 | XGN66 | XGN66 | XGN66 | XGN66 | XGN66 | XGN66 |
| GN301 | 1000A | 630A | 630A | 630A | 630A | 630A | 1000A | 630A | 630A630A | 630A | 630A | 630A | 1000A |
| VS1-12Breakr | 1250/31.5 | 630/20kA | 630/20 | 630/20 | 630/20 | 31.5A1 | 630/20kA 1 | 630/20 | 630/20 | 630/20 | 1250/31.5 | ||
| 45,0/5120 | 420g | 100/5012 | 1.05/5vel | 4.200 | 2000 | 200 | 400.25,200 | ||||||
| JDZJ-10 Voltage transformer | 15:0.13 013:0.1/3 | 10503 03:0.13 | |||||||||||
| RN2-10 Fuse | 3 | 1 | 3 | 1 | |||||||||
| HY5WZ-12.7/50 Lightning arrester | 1 | 3 | 1 | 1 | 1 | 1 | 1 | 3 | |||||
| GSN-10 Electrification display | 1 | 1 | 1 | 1 | 1 | 1 | 1 | 1 | 1 | ||||
| LJ-100Zero sequence transformer | 1 | 1 | 1 | 1 | 1 | 1 | 1 | 1 | 1 | ||||
| Microcomputer protection device | Be mounled on protcction screen of main transformer | 1 | 1 | 1 | Be mounted on protcction of main transformer | ||||||||
Overview
Compactbox-typesubstationof24kV(15kV)(hereinafterreferedtoasbox-typesubstation)takestheadvantagesofforeignboxtypesubstatiosmpysttchqesdvancedectricrtsndHtomatedecnologittsteitsf thestategridautomationandelectricpowerrequirements.Itisformedaboxorseveralboxes thatareassembledwithHVswitchgear disriutiontranfoLViearicgteringpmtdrompesaiopntnteldle isinstalldonitsandLsidetoeachtereqirementsofutomationintedistrbutiongriddreaieteremotecotroote sensing,remotesignaingndremoteregulatingasellasuppercomputersystemmanagement.Thisqipmentisaplicableforthe locationssuchasterbanhigisebildings,esidentialousesindustrialandminingnterprises,unicipalconstructisoad andstreetlampsasellasthetemporaryconstructions.Itasmanyadvantagessuchastestrongcompleteness,shortinstaltion period,lti harmonize with the surroundings.
Modelandmeaning
Useenvironmentalconditions
Normal service conditions of outdoor box-type substation
a)Theambient temperatureshall not exceed + 4 0 ^ { \circ } \mathsf C ，andtheaverage temperaturewithin24hshall notbemore than + 3 5 ^ { \circ } C .The min ambienttemperaturemaybe-10degree5and - 2 5 ^ { \circ } C .What'smore,the sharpchange of temperature shallbe taken into consideration. b)The sunshine radiation of 10ooW/m2(At noon ona cloudless day shallbe taken into consideration.
c) The altitude shall not be higher than 3 , 0 0 0 { m }
d)Iftheambientairisubjecttoteplltionofustsmoke,orroivegssteamoraltmistthpoltionclasssallnotced the class Il.
e)Forclassteiceoatingticknesssalnoteceedmfass10itallotethickerthanmm;andfoss;it shall notbemore than 2 0mm
f)Thewind speed shall not exceed 3 4 m / s
g)The condensation and precipitation shall be taken into consideration.
h)The inductive electromagneticdisturbance voltagerangeshallnotbemore than1.6kVin thesecondarysystem.
Specialserviceconditions
If beyondthenormal serviceconditions mentionedinclause 3.1,please contactand negotiatewith the manufacturer.
Themaintechnicalparameters
Ratedvoltage(Ur):On the HVside:24kV/15kv On the LVside:0.4kV
Auxiliarycircuit:AC110V,220Vand380V;DC24V,110V,125V
Rated capacityof transformer:100,125,160,200,250,315,400,500,630,
800，1,000,1,250，1,600kVA
Ratedcurrent (Ir):On the HVside:400A and 630A On the LVside:Max2,500A
Rated frequency (fr):50Hz
Rated short-time withstand current (lk):
HVswitchgear:16kA2s(4s),20kA2s(4s)
LVswitchgear:15kAfor315\~500kVA
30kAfor630\~1,600kVA
Test time:1s
If the capacity of transformer is less than 315kVA,the equipment willbe exempted from the test. International protectionof enclosure:Not lower than IP23D
Structuralfeatures
1.Thisdesignconsderstetritoryronentandarietyofustomerdemands,itmplystemodularructurembd with following types.
AccordingtotheHVswitchconnectingwiththepowergrid:ringnettype,terminaltype,HVenergymeteringtype,LVenergy metering type.
According to the equipment arrangement:Chinese character"."type structure and Chinese".typestructure.
According to the typeofbuilt-in transformer:oil-immersed full-seal transformeranddry-type transformer.
AccordingtothetypeofHVswitch:vacuumtypeloadswitchandcombinationunitswitchgearSF6loadswitchandcombination unitswitch,gas-filled switchgear
According to thematerial of box body(enclosure):metallicenclosureand non-metallicenclosure
Themetallcenclosureandframeareweldedwiththebeamchannelandsteellbeam,thesidewallandtopcoverisof twolayerasemblytheouterhasthestingpinndmountingpin,themetalidorhasthegoodearthinglineandteunderrameand foundationaoctiartodctoreossaldoothsoafoiate andrepairofthetransformerandsafeandisolatingnetdoorstopreventpersonenteringintoeectricalisolatingareabymistakeand guarantee the safety of equipment and human.
2.Goodventltionmeasures:thestructureofboxbodyisoftwolayers,thetopofboxiselsemadeofheat-isolationmateril whichcanlowertheriseofindortemperaturecausedbythesunshineandthereisanautomaticventltormountedatesidedoorof HVchamber,which can ensure transformer runsafely in fulload in the high temperature season.
3.TheHVswitchgearonHVside provided with five-preventionmeasuresand thereisanenergizedreliablelock with the transforercompartmenttoensurethehumansecurity.ThegradeProtectionofboxbodycanreachIP23D:Ithasgoodrain-proof performance.
4.Convenient operation and maintenance
TherearesomevisiblemarksoutsideoftheboxtypesubstationindicatingtheHVcompartment,troughopeningthecompartment doors,theycanbeeasilyoperatedandrepaired,eachcompartmenthastheautomaticlightingdeviceeventhecompartmentof transformerisusedforinstalingmaintainingandchangingthetransformerinaddionLVcompartmentisofforceconnectionandfor repairing thechannels.
5.Nice appearance and durability
TheenclosureismadeofA-platesandcolorstelsandwichplates,itisgiventhepre-treatmentandplatingtreatment,bsides italsocanbenon-metalicenclosuremadeofaglassfiberandspecialcementandwiththespecialtechnologysoithastheobvious advantageliketestrongplasticityofappearancecoroionrsistanceheatisolatioadsoundisolationet.esufceatingis beautiful and durable,with high cohesion and soft color sense.
High-sidemaincircuitscheme
| Scheme No. | 2 | 3 | 5 | 6 | 7 | ||
| Line diagram | (H④-) | ? | |||||
| Purpose | Wire incoming and outgoing | Wire incoming and outgoing | Wire incoming and outgoing | Wire incoming and outgoing | Wire incoming and outgoing | Voltage transformer cabinet | HV metering cabinet |
Low-sidecircuitscheme
| Scheme No. | 2 | 3 | 5 | 6 | 7 | ||
| Line diagram | 中中中 鑫 | 中 | |||||
| Purpose | Electrification | Electrification | Electrification | Feeding | Reactive compensation | Reactive compensation | Low-voltage metering |
Typicalsystemscenarioexamplereference
Cable incoming and outgoing;ring net power supply;HV supplyandLVmetering;manual operation
Cable incoming and outgoing;terminal power supply;HV supplyandLVmetering;manual operation
Cable incoming and outgoing;ring net power supply;HV supplyandLVmetering;electrical operation
Example of compact type combinationscheme
YBM
Intelligent prefabricated substation
Respectingpromiseandkeepingpromise,operatingintherightway,strivingfor perfection,coexistenceandwin-winsituation
Overview
This ntellient integratedtransformersubstationisanationalizedtypeAmericanboxsubstationdevelopedbycompany.Asan importantpoplyitinblisttiotworkitsegatedfabatedoductofageotrolotio power transformation and power distribution,which is widely used in the urbanand rural distribution network.
Thehighvoltageloadswitchandhighvoltagefuseareputintothetransformeroil,sothisproducthastwostructureformsofone boxanddividedboxwiththetransformerbodyTeoilboxisoffullsealedstructurewithoiltemperatureindicatoroillevelgauge presuregauge,pressurereliefvalveandoildrainvalvetomonitortheoperationconditionofthetransformer.Thiskindofproducts hasthreetypesofpowersuplymodesringnetworktype,terminaltypeandpowertype.Inordertomaketheproductmettheactual demandsof thepowergridinChinaeterJONCHNCompanypromotesplugpulldrytypefuseandthefusingofthefusewirehasno effecttotheperformanceoftransformeroilAcordingtothecomplicateddegreeoflowvoltageoutgoingdemands,thisproducthas threetypesofenclosure-standardtypereinforcedtypeandintegratedtype,asaresut,theclientsnddesignagentshavemore choices.
Modelandmeaning
YB M □ (kVA)Ratedcapacityoftransformer (kV) Rated voltageof low-voltageside (kV) Rated voltageof high-voltageside Design serial No. This integrated transformer substation
Highvoltagemaincircuitcommonscheme
1.Ambient temperature: maximum + 4 0 ^ { \circ } \mathsf C ，minimum 3 0 ^ { \circ } C ： 2.Altitude:≤3000m 3.Wind speed: About34m/s (≤700Pa); 4.Humidity:Average daily relative humidity 5 9 5 % Average monthly relative humidity <= 9 0 % 5.Shake-proof:Level acceleration≤0. 4 m / 5 2 ;vertical acceleration≤0.15m/s2; 6. Gradient of installation position:≤ 3 ^ { \circ } ： 7.Installngenvironmentambientairasnotbeenobviouslypolutedbycorrosiveorfammablegasandthreisnorongfeeling Df shock. 8.Please negotiate with the company when the purchased product is beyond above stipulated conditions.
Productratedparameters
| Rated voltage | 10kV/0.4kV |
| Ratedvoltage of high-voltageside | 10kV |
| Max.voltage of high-voltage side | 12kV |
| Rated voltage of low-voltage side | 0.4kV |
| Rated frequency | 50Hz |
| Thermal stability capacityof high-voltageswitchgear | 20kA/2S |
| Rated short-circuit breaking capacity of low-voltage main circuit switch | 35kA |
| Rated short-circuit breaking capacity of low-voltage branch circuitswitch | 35kA |
| Transferredcurrentof high-voltage loadswitch | >1500A |
| Noise level | 50dB |
| Protective grade of case | Not less than IP3X |
Insulationlevel
| Ratedvoltage | 10 | 0.4 | ||
| Transformer | Switchtoearthandinterphase | Switchisolatinginter-fracture | ||
| Power frequency withstandvoltage | 35 | 42 | 48 | -2.5 |
| (kV)Peak impulse withstandvalue | 75 | 75 | 85 | |
Structuralfeatures
Theframework structureofthebox enclosure is madeof channel steelandanglesteelwith highermechanical strength.the enclosureismadeofluminumalloyplatewithsmoothsurface,beautifuloutlineandbettranticorrosionperformance,thebase oftheboxbodyis3-60mmhigherthanthegroundAllthedoorsofteboxenclosureareopentooutsideandtheopening angleis larger than 9 0 ^ { \circ } and is set with location device,handles,secret door,as wellas built-in locks which have the functions ofrainprotectionanti-blockageandrustprotection.theboxbodiesareof theful-sealedtheft-proofstructure.toassurethe operationunderthenormalambientair temperature,thetemperatureofalltheelectricalequipmentcan'texceedthemaximum allowabletemperature,andtheboxbodyhasenough naturalventilationopeningsandheatinsulation measures.Thebox body oftheprefabricatedsubstationisdesignedwithspecialgroundingconductor,onwhichtherearemorethan2fixedconnecting terminalsconnectedtothegrounding networkandonwhichthereareobvious groundingmarks.Thegrounding terminalis the copper bolt,the diameter of which is not less than 1 2mm .the grounding conductor is made from copper strip,the current density of which is not higher than 2 0 0 \mathsf { A } / \mathsf {mm } 2 and the cross section of which is not less than 3 0mm ^ { 2 } ,and itis guaranteed that there is noovereatandthereisnobadeffecttothesafetyof thesurroundingobjectswhenthemaximumshortcircuitcurrentpases. thedynamicand thermalstabiltycurrentthatthespecialgroundingconductorendures mustbecombinedwiththegrounding mode of high voltage power distribution device.
Productratedparameters
For10kVprefabricated substationperformance levelof S9,S10,S11seriesoil-immersed transformer
| No | cRatetyh ta | Ratedvoltage | vlotwge Voltage | Conection | No-loadcurrent | Loss | Impoedance | Noise | Temperature | ||||||
| traning | s9 NS10 S11 | ||||||||||||||
| S9 | S10/ | ||||||||||||||
| 1 | 30 | (0.) | (±22.5) | 2.2 | 2.0 | 130 | 600 870 | 55 temprature 65coil 65° | |||||||
| 2 | 50 | 2.0 | 1.8 1.5 | 170 200 | |||||||||||
| 3 | 63 80 | 1.9 1.7 | 1.2 | ||||||||||||
| 4 | 250 | ||||||||||||||
| 5 | 100 | 1.6 | 1.1 | 290 | |||||||||||
| 6 | 125 | 1.5 | 1.0 340 | 270 | 1800 2200 | ||||||||||
| 7 | 160 200 | 1.4 1.4 | 1.0 400 0.8 480 | 310 375 | 2600 | ||||||||||
| 8 | 6 6.3 | 1.2 | 0.8 | ||||||||||||
| 9 | 250 10 | Yyn01 | 560 455 | ||||||||||||
| 10 | 315 | 1.1 | 0.7 | 670 | 540 | 400 475 | 3650 | 3600 | |||||||
| 11 | 400 | 1.0 | 0.7 | 800 | 650 | 570 | 4300 | 4200 | |||||||
| 12 | 500 | 1.0 | 0.6 | 960 | 775 | 680 | 5100 | 5000 | |||||||
| 13 | 630 | 0.9 | 0.6 | 1200 | 920 | 800 | 6200 | 6000 | |||||||
| 14 | 800 | 0.8 | 0.6 | 1400 | 1120 | 980 | 7500 | 7400 | |||||||
| 15 | 1000 | 0.7 | 0.5 | 1700 | 1320 | 1150 | 10300 | 9860 | |||||||
| 16 | 1250 | 0.6 | 0.5 | 1950 | 1560 | 1360 | 12800 12000 | ||||||||
| 17 | 1600 | 0.6 | 0.5 | 24001880 | 164014500 | ||||||||||
Productratedparameters
| Rated current(A) | Rated voltage(KV) | Impulse withstand voltage(KV) | Powerfrequency (1min.kV) | Ratedshort-time (kA/s) | Short-circuit (kA) | Ratedpeak withstandvoltagewithstandcurrentmakingcurrentwithstandcurrent （kA) | Number ofload operation(kA) | Numberof mechanical operation |
| 315 | 12 | 75 | 42 | 12.5/2 | 31.5 | 31.5 | 100 | 2000 |
| 630 | 12 | 75 | 42 | 16/4 | 40 | 40 | 100 | 3000 |
Schematicdiagramofmaincircuit
| Scheme No. | 2 | 3 | 4 | |
| Systemscheme | ||||
| FYN-12Chargeswitch | For terminal use 315A/630A | Ring network power supply 315A/630A | High voltage metering 315A/630A | Dual powersupply 315A/630A |
KYN61-40.5(Z)
Armored removable AC metal enclosed switchgear
Respectingpromiseandkeepingpromise,operating intherightway,strivingfor perfection,coexistenceandwin-winsituation
Overview
KYN61-40.5(33)typealternating-curentmetal-cladandmetal-enclosedwithdraw-ableswitchgear (hereinafterreferred toas switchgear)isa indoor completesetof power distribution unit of three-phase AC5oHz and rated voltage of 4 0 . 5 \mathsf { k V } . Used for receiving anddistributingttrginoentsafobatiogdustralterrstctoosott anddetectsthecircuitslsoispplicabletofreuentoerationlcatios.hissitchgeaomplswithGB/-999B90 1991,DL404-1997,etc.
Mainfeature
1.Cabinet structure is of assembly type,the circuit breaker adopts floor type handcart structure;
2.Equippedwitbrandcompositeisulatedacumircuitbeakerisfeaturedwitgoodinterchangeabilityndisipleto change;
3.Thehandcartframeismountedwithleadsrewnutpropelingmechanismitisabletoovethendcarteasilyndrevent damage of propelling mechanism caused bymis operation;
4.All operations can be carried out when the cabinet door is closed;
5.Interlockingamong themainswitch,handcartandswitchgearadoptscompulsory mechanicallockingmode,meetingthe"five preventions" function;
6. Cable chamber is large enough,it could connect multi cables;
7.The fast earthing switch is used for earthing and circuit short-circuit;
8.Degreeof protection of the enclosure is IP3X,and is IP2Xwhen the doorof handcart chamber is opened;
9.The product complies with GB3906-1991,DL404-1997and refers to the international standard IEC-298.
Useenvironmentalconditions
1.Ambient temperature: - 1 0 ^ { \circ } C ~ + 4 0 ^ { \circ } C ，mean value measured within 24h should not exceed 35C. 2.Altitude: not exceed 3000m; 3.Relative humidity: daily mean not over 9 5 % ,monthly mean not over 9 0 % 4.Seismic intensity:not beyond Ms8; 5.Vapor pressure:daily mean not over 2 . 2 \mathsf { k P a } ，monthlymeannot over 1 . 8 \mathsf { k P a } 6.Ambienteottistalloitudfroffirxpoivnersltiomalrooee ibration.
Vacuumswitchgearmaintechnicalparameters
| Name | Unit | Data |
| Rated voltage | A | 40.5 |
| Rated current | Hz | 125016002000 |
| Ratedfrequency | kA | 50 |
| Rated short-time withstand current | kA | 202531.5 |
| Rated peakwithstandcurrent | kV | 506380 |
| Ratedpower frequencywithstandvoltage | kV | 95/1min |
| Rated lightning impulse withstand voltage | S | 185 |
| Rated short-circuitduration | 4 | |
| Degreeof protection | IP3X |
| Name | Unit | Data |
| Rated voltage | kV | 40.5 |
| Rated frequency | Hz | 50 |
| Rated power frequency withstand voltage | kV | 95/1min |
| Rated lightning impulse withstand voltage | kV | 185 |
| Rated current | A | 1250 1600 2000 |
| Rated short-time withstand current | kA | 20 2531.5 |
| Rated short-time breaking current | kA | 2025 31.5 |
| Rated peak withstand current | kA | 506380 |
| Rated short-circuit duration | ms | 4 |
| Opening time | ms | 30≤t≤60 |
| Closing time | S | 50≤t≤100 |
| Rated short-circuit breaking current times | times | 20 |
| Mechanical life | times | 10000 |
Springoperatingmechanismmaintechnicalparameters
| Name | Unit | Data | |
| Rated operating voltage | Opening coil | V | DC220/110,AC220/110 |
| Closing coil | |||
| Ratedoperatingcurrent | Opening coil | A | 0.96(220V),1.05(110V) |
| Closingcoil | |||
| Power of energy-storage motor | W | 230 | |
| Rated voltage of energy-storage motor | V | DC220/110,AC220/110 | |
| Energy-storage time | S | ≤12 | |
Switchgearstructurefeatures
Outline dimension of switchgear Outline dimension (WxDxH) 1400x2800x2600(reference)
Structural schematic diagram ofswitchgear Arelay meterchamberB buschamberC circuit breaker chamberDcable chamber
Switchcabinetinstallation
Schematic diagram of installation foundationof switchgear a.The height of the electrical room:≥4500mm; b.Distance from the back of the cabinet to thewall:≥1500mm; c.Theflatnessofthe infrastructure:≤1mm/m2; d.The part of the foundation pre-buried channel steel above the ground shall not exceed 3mm.; e.lt can be fixed on the foundation by bolt or welding.; f.The weight of switchgear is about 1800kg; g.Switchgear operation corridor width (single column):≥ 3000mm;Double-sided (face to face) >= 4000mm
Examplescenario
Primarywiringschemesofswitchgearinclude27typicalschemes,meetingusersdemandsoncableincomingandoutgoinglines， verheadincomingandutgoinglinestiemeasurementandprotection,ifrequireotherschemes,pleasecontactthemanfacture
| Schemenumber | 2 | 3 | 4 | |||
| Primarycircuitdiagram | 88 ① | ①① | ||||
| elMmints | Ratedcurrent | 1250，1600,2000 | ||||
| Circuit breaker ZN85-40.5 | 1 1 | 1 | ||||
| Currenttransformer LDBJ8(9)-35 | 1 | 2 | 3 | |||
| Earthingswitch JN22- | 1 | 1 | 1 | 1 | ||
| 40.5/31.5 | ||||||
| Application | Overhead outgoing line Overhead outgoing line Overhead outgoing line Overhead outgoing line | |||||
| Schemenumber | 5 | 6 | 7 | 8 | |
| Primary circuit diagram | H 84 | 串 | |||
| elements Main | Ratedcurrent | √ | 7 | ||
| Circuit breaker ZN85-40.5 | 1 | 1250,1600,2000 1 | 1 | 1 | |
| Currenttransformer LDBJ8(9)-35 | 1 | 2 | 3 | ||
| Earthing switch JN22- 40.5/31.5 | 1 | 1 | 1 | 1 | |
| Application | |||||
| Cableoutgoing line | Cableoutgoing line | Cable outgoing line | Cable outgoing line | ||
| Schemenumber | 9 | 10 | 11 | 12 | ||
| Primary circuit diagram | H ①4 ① | ? | ||||
| elmmints | Rated current | 1250,1600,2000 | ||||
| 1 | 11 | |||||
| LDBJ8(9)-35 | 12 | 13 | ||||
| Application | Left (right) tie | Left (right) tie | Left (right) tie | Left (right) tie | ||
| Rated current | |||||||
| 1250,1600,2000 | |||||||
| Circuit breaker ZN85-40.5 | 1 | 1 | 1 | 1 | |||
| Current transformer LDBJ8(9)-35 | 1 | 2 | 3 | ||||
| Left (right) tie | Left (right) tie | Left (right) tie | |||||
| Application Left (right) tie | |||||||
| Schemenumber | |||||||
| Primarycircuitdiagram | 13 | 14 车 | 15 # 84 8 | 16 | |||
| elemints | Rated current | 1250,1600,2000 | |||||
| 1 | |||||||
| LDBJ8(9)-35 | 11 | 12 | 13 | ||||
| Application | Isolation, tie | Isolation, tie | Isolation, tie | ||||
| Schemenumber | Isolation, tie | ||||||
| Primarycircuitdiagram | 17 | 18 X 》 4 | 19 | 20 ① | |||
| elmints | 4 | ||||||
| Rated current Circuit breaker ZN85-40.5 | 1 | 1250,1600,2000 | |||||
| Current transformer | 1 | 1 2 | 1 3 | ||||
| LDBJ8(9)-35 | |||||||
| Application | Cable outgoing line | Cable outgoing line | Cable outgoing line | Cable outgoing line | |||
| Schemenumber | 21 | 22 | 23 | 24 | ||
| Primarycircuitdiagram | DH | ①4 ① ① ① | +① | |||
| elMmints | Rated current | 1250,1600,2000 | ||||
| 1 1 | 1 | 1 | ||||
| LDBJ8(9)-35 | 2 | 3 | ||||
| Application | Overhead outgoing line | Overhead outgoing line Overheadoutgoing line | Overhead outgoing line | |||
| Schemenumber | 25 | 26 | 27 | 28 | ||
| Primary circuit diagram | 8 | 个 | 个 8 | |||
| elMaints | Rated current | 1250,1600,2000 | ||||
| Current zx9-sformer | 2 | 3 | 3 | |||
| Fuse XRNP-35 | 3 | 3 | 3 | |||
| LightningarresterYH5WS- 51/134Q | ||||||
| Application | Voltage transformer | Voltage transformer | All transformer | |||
KYN28-24(15)
Armored removable AC metal-enclosed switchgear
Respectingpromiseandkeepingpromise,operating intherightway,strivingfor perfection,coexistenceandwin-winsituation
Overview
KYN28-24(15)seriesalternating-curentmetal-cladandmetal-enclosedwithdraw-ableswitchgear(hereinafterreferrdtoas "switchgear)isacompletesetofpowerdistributionunitofthre-phasesinglebusandsinglebussectionsystemof15kVandAC 5 0 ( 6 0 ) H z
Thisswitchgearismainlyaplicable topowerplants,powertransmitingofmidleandsmallsizedgeneratorsdistributionof industrialndgnterpselectricityecevgndtrasmitingofcodarysbstatiosllsartingoflgeolae motors,etc,realizes control protection and monitoring.
Itasfivepreventions",itpreventson-loadpushingorpulingicuitbreakershandcartpreventsmakingorreakingcicuitbeaker bymistake,preventscosingcicuitbreakerhentherthingswitchisatlosingpositionpreventsenteringintolivecompartentby mistake,andpreventsclosingearthingswitchunderlivecodition.ItcanbeequippedwiththeNV-24(15)typevacuumcircuibeaker developed byourcompany,itreally isan ideal distributionequipment with perfect performances.
It complieswith the standards GB3906,GB/T 11022and IEC60298.
Modelandmeaning
Useenvironmentalconditions
1.Ambient air temperature: - 1 5 ^ { \circ } C ~ + 4 0 ^ { \circ } C
2.Altitude: <= 3 0 0 0 0 m ：
3.Relative humidity:daily mean relative humidity not over 9 5 % ,monthly mean not over 90 %
4.Seismic intensity:not beyond Ms8;
5.Theinstallationsite shouldbefreeoffre,explosivedanger,seriouspolltion,chemicalcorrosionorevere vibration.
6.IftheproductisintendedforlocationsbeyondthenormalserviceconditionsstipulatedbyGB3906,pleasenegotiatewithour company.
Themaintechnicalparameters
| Name | Unit | Data |
| MatchedcircuitbreakerNV1-24(15) | ||
| Rated voltage | kV | 24(15) |
| 1min power frequencywithstand voltage | kV | (50)65 |
| Rated impulse withstand voltage (peak) | kV | 125 |
| Rated frequency | Hz | 50(60) |
| Rated current | A | 630 1250 1600 20002500 3150 |
| Rated current of branch bus | A | 630 1250 1600 2000 2500 |
| Rated short-time withstand current | kA | 16 20 25 31.5 |
| Rated peak withstand current | kA | 40 50 6380 |
| Rated short-circuitduration | S | 4 |
| Degree of protection | Theenclosure is IP4X,itis IP2Xwhen the compartmentdoorand circuit breakerchamberdoorareopened | |
| Mass | kg | 8001000 (Rated current 1600A above) |
Productstructureperformancecharacteristics
1.Switchgear of 24kV(15)with compact volume
Structureof thisproductissimilartothatofmid-setswitchgearof12kV,theproductisapplicabletosystemsof24kV/15kV need not composite insulation or interphase separator,with outstanding insulation performance.
2.Safestructure,flexible installation
This switchgeariscomposedof cabinetbodyandmid-setwithdrawablepart(i.e.handcart)two parts.Thecabinet body isdividedintofourseparatecompartments,degreeofprotectionoftheenclosureisIP4X,andtheprotectiodegreeisI2X whencompartmentdoorsand circuit breakerchamberdoorareopened.Ithasoverhead incomingandoutgoinglines,cable incomingandoutgoing linesandotherfunctionschemes,itcanbecomepowerdistributionunitofdiferentschemesand forms afterpermutationandcombination.Thisswitchgearcanbeinstaled,debuggedndmaintainedfromthefrontside,soitcanbe arrngedinduplexbymeansofback-to-backorarrngedagainstthewal,whichnotonlyimprovesitssfetyndfexibilitybut alsoreduces the floor space.
4.Varioushandcarts,convenientoperation
Framework of the handcartis madeupof steelsheets through machiningof CNC machine tool.The handcart has good insulationcoordinationwiththecabinetbodywithsafe,reliableandflexiblymechanicalinterlocking.Itcanbedividedinto circuit breakerhandcart,voltagetransformerhandcartandisolatinghandcartaccordingtothepurposes,handcartsofthesame specificationare exchangeableabsolutely.
Therearebreakingposition,testpositionandworkingpositioninthecabinetbodyforhandcart,each positionhaspositioning devicerespectivelythatguaranteesreliableinterlocking,mustcarroutoperationaccordingtotheinterlockinganti-misopration procesAllhandcartsadoptleadscrewtorotatetopushinoritdrawitisonvenientandflexibletooperatesuableforal kindsofoperatorsondutyWhenitisrequiredtoremovethehandcartfromtheabinetbodypleaseuseaspecialtransfercarto takeitoutcoveintltetyutispectisdmntenanceitdoptsdttyaluisett check and maintain.
1.Main bus 2. Small branch bus 3.Bolt 4.Cushion block
Themaincircuitschemediagram
| Schemenumber | 2 | 3 | 4 | ||
| Scheme of primary wiring | HH P | 个 ? | |||
| Electrical element of main circuit | Dim.of cabinet body (WxDxH) mm | 立 1000×1820×2300 | - 1000×1820×2300 | 1000×1820×2300 | |
| (A) Rated current | 630~3150A | ||||
| Vacuumcircuit breaker NV1- 24(15) | 1 1 1 1 | ||||
| Current transformer LZZB9- 24(15) | 2~3 | 2~3 | 2~3 2~3 | ||
| Voltage transformer | |||||
| High-voltage fuse | |||||
| Earthing switch | 1 | 1 | |||
| Lightning arrester | Powerreceiving, | Power receiving, | 3 Powerreceiving, | Power receiving, | |
| Application Remark | feeding feeding feeding feeding | ||||
| Schemenumber | 5 | 6 | 8 | ||||
| Scheme of primary wiring | ①① | ||||||
| Electrical element of main circuit | Dim.of cabinet body (WxDxH) | 1000×1820×2300 | 1000×1820×2300 | 1000×1820×2300 | 1000×1820×2300 | ||
| mm (A)Rated current | 630~3150A | ||||||
| Vacuum circuit breaker NV1- 24(15) | 1 1 1 | ||||||
| Current transformerLZZB9- | 3 | 3 | 3 | ||||
| 24(15) Voltage transformer | 1 | ||||||
| High-voltage fuse | 2 | ||||||
| Earthing switch | 1 | ||||||
| Lightningarrester | 3 | 3 | 3 | ||||
| Application | Powerreceing, | Power reiceving, | Powereceiving, | Isolation | |||
| Remark | |||||||
| Schemenumber | 9 | 10 | 11 | ||||
| Scheme of primary wiring | 12 | ||||||
| Electrical element of main circuit | Dim.ofcabinetbody (WxDxH) | 1000×1820×2300 | 1000×1820×2300 | 1000×1820×2300 | 1000×1820×2300 | ||
| mm (A) Rated current | 630~3150A | ||||||
| VacuumcircuitbreakerNV1- 24(15) | |||||||
| Current transformerLZZB9- | |||||||
| 24(15) Voltage transformer | 2~3 | 3 | 2~3 | ||||
| High-voltage fuse | 3 | 3 | 3 | ||||
| Earthing switch | |||||||
| Lightning arrester | 3 | ||||||
| Application | Bus tie isolation | Voltagemeasurement Voltage measurement Voltage measurement | |||||
| Remark | |||||||
| Schemenumber | 13 | 14 | 16 | ||||
| Scheme of primary wiring | 888 | 15 888 | |||||
| Electrical element of main circuit | Dim.of cabinet body (WxDxH) mm | 1000×1820×2300 | 1000×1820×2300 1000×1820×2300 | 1000×1820×2300 | |||
| (A) Rated current | 630~3150A | ||||||
| Vacuumcircuitbreaker NV1- 24(15) | |||||||
| Current transformerLZZB9- | |||||||
| 24(15) Voltagetransformer | 3 | 3 | 3 | ||||
| High-voltage fuse | 3 | 3 | 3 | ||||
| 3 | |||||||
| Earthing switch | 3 | 3 | |||||
| Lightningarrester Application | Measurement + tie | Fuse | Measurement + tie Measurement+ tie | ||||
| Remark | |||||||
| Schemenumber | 17 | 18 | 19 | 20 | |||
| Scheme of primarywiring | 个 4H8 | & | 818 | 个 888 | |||
| Electrical element of main circuit | Dim.ofcabinetbody(WxDxH) mm | 1000×1820×2300 | 1000×1820×2300 | 1000×1820×2300 | 1000×1820×2300 | ||
| (A) Rated current Vacuumcircuit breakerNV1- | 630~3150A | ||||||
| 24(15) | 1 1 | ||||||
| Current transformer LZZB9- 24(15) | 2~3 | 2~3 | 3 | 3 | |||
| Voltage transformer | 2 | 3 | |||||
| High-voltage fuse | 3 | 3 | |||||
| Earthing switch | |||||||
| Lightning arrester | 3 | ||||||
| Application | Tie | Tie | Tie+metering | Tie+metering | |||
| Remark | |||||||
| Schemenumber | 21 | 22 | 23 | 24 | |
| Scheme of primarywiring | D | ||||
| Electrical element of main circuit | Dim.of cabinet body (WxDxH) mm | 1000×2150×2300 | 1000×2150×2300 | ||
| (A)Ratedcurrent | 630~3150A | ||||
| Vacuumcircuitbreaker NV1- 24(15) | 1 1 | ||||
| Current transformerLZZB9- 24(15) | 2~3 | 3 | |||
| Voltage transformer | |||||
| High-voltage fuse | |||||
| Earthing switch | |||||
| Lightning arrester | 3 | ||||
| Application | Tie | Overhead incoming line | |||
| Remark | |||||
KYN28A-12(10-11KV)
Armored removable AC metal-enclosed switchgear
Respectingpromiseandkeepingpromise，operatingintherightway，strivingfor perfection,coexistenceandwin-winsituation
Overview
Thisequipmentisindoormetalarmoringwithdraw-ableswitchgear(hereafterrefertoasswitchgear.3.6-12kilovolthrephaseC 50Hzsinglebusbarandthesinglebusbarsubsectionsystem'scompleteelectrityditributionequipmentisusedinthepowerplant smallandmedium-sizedgeneratorpowertransmissionindustryndminingbusinesspowerdistributionasellaseectricalidustry system'ssecondtransformersubstation'selectrictake-over，powertransmisionandlarge-scalehighpressuremotorstartingandso on.Thepurposeistocontrol,protectandmonitor.ThisswitchequipmentisuptothestandardofIEC298、GB3906andcanprevent thechargefrompusingndulingteakefromogdosingteakerfrosulationitctrityafro earthedwitchcosingthebreakerfromopeningtheswitch'snterlockwhenitwithelectricitymistakenly.ItcannotonlyusewithVSl vacumcircuiteketitBBoporatios4ceakerItsddindfrisrioti superior performance.
Useenvironmentalconditions
1.Normal condition a.Surrounding air temperature:- 10C ~ + 4 0 ^ { \circ } \mathsf { C } b.Altitude:1000M c.Relative environment humidity:The daily relative humidity average is not higher than 9 5 % ,themonthly relative humidityaverage is not than higher 90 % （20 d.Earthquake:The intensity does not exceed 8 degree. e.The surrounding airwithout corrosive or flammable gas or water vapour. f.Withoutalotofdrtinessandregularfiercevibration,undertheseverecondition,theintensitymeetsthefirstkindrequirement. 2.special working conditions \*Whenitisused beyond thenormal environmental condition stipulatedin theGB3906,theusershould consult with the manufacture.
Themaintechnicalparameters
| Item | Unit | Data | |
| equippedwithbreaker | |||
| ZN63A-12(VS1) | VD4 | ||
| Rated voltage | kV | 12 | 12 |
| 1 min working frequency endurable voltage | kV | 42 | 42 |
| Shock endurablerated voltage | kV | 75 | 75 |
| Rated frequency | Hz | 50 | 50 |
| Rated current | A | 630、 1250、 1600、 2000、 | 2500、3150、 4000、 5000 |
| Branch bus bar rated current | A | 630、 1250、 1600、2000、 | 2500、 3150、 4000、 5000 |
| Rated short time endurable current(virtual value) | kA | 16、 20、 25、 31.5、40、 50 | 16、20、 25、 31.5、 40、 50 |
| Rated peakendurable voltage | kA | 40、 50、 63、 80、 100、 125 | 40、50、 63、 80、 100、125 |
| Rated short-circuit duration | s | 4 | |
| Protectiondegree | The shellis IP4X,and when the compartment door and handcart door areopen,itisIP2X | ||
| Quality | kg | 700~1200 | 700~1200 |
StructureIntroduction
TheswitchequipmentisdesignedaccordingtoGB3906-91metalarmoringsealswitchequipment.Therectferbodyismadeup ofthecabinetbodyanddraw-outparts(namelyhandcart)placedinthemiddle.Seecharter1.Thecabinetdividesintofoureparate rooms,theoutercoveringprotectiongradeisIP4Xheneachsmalloomandthecircuitbeakerisopened,theprotectiongradeis IP2XItasuspdtenetutetnable'setutetlidrtioplaeragdddio eachkindofplanformofthepowerdstributionequipmentTisswitchequipmentmaybeinstaledandmaintainedfromthefrontage thereforeitmayompoetalangementacktackdistaledinsttall,mprovingtewiipmntsity and flexibility and making full use of the occupying area.
Switchgearstructurediagram
A、the bus bar room
B、the circuit breaker handcart room
C、the cable room
D、the relay instrument room
1、cover
2、branch small bus bar
3、bus bar pipe
4、main bus bar
5、static contact installation
6、contact box
7、current mutual induction
8、earthed switch
9、cable
10、arrester
11、earthed main bus bar
12、mother board
13、control the small bus bar
14、earthed switch operating mechanism
15、draw-out horizontal clapboard
16、heat installation
17、circuit breaker handcart
18、twice connector
19、clapboard (valve)
20、loadingandunloadingclapboard
21、decompression channel
SwitchgearDimensions
SwitchgearDimensions
Handcara
TheframeworkofhandcartismadeofsteelsheetroughtheprocessionofCNCmachinetoolandrivetwelding.According tothe aplication,tdartseditiitakerdcartaeafodartotigcartdei handcar,etc.Thehandcartsofthesamespecificationcanbeexchangedconveniently.Inthecabinet,thehandcarthasisolating position,testingpostioadoeratigpositioachfichissigndithlocatidvicetosretattheadcartcatoe easilyat theabove-mentioned positions,while the interlock mustbe unlocked to move the handcart.
B Buschamber
Thebusisledfromoneswitchcabinettoanotheroneandfixedwith staticcontactboxthroughbranchbus.Thefatbranch bus is connectedthroughtheoltothestaticcontactboxandmainbusotneedinganyotherlinclampsorinsulators.Whenthereisspecial demandoftheclientsortheproject,theconnectingboltonthebusbarcanbeencapsulatedwithinsulationandendcap.Whenthebus croestheblftesichcbintfiitwithususingsotatiftereisyintealfutarcitanpreventtfltding to another cabinet and can guarantee the mechanical strength of the bus.
Cablechamber
Insidethecablecamber,tecurrenttransformer,groundingswitcharrsterandcablecanbeinstalldandonteotoms designed slotted removablealuminumsheet toassure theconvenient siteconstruction.
SwitchgearDimensions
D Relayinstrumentchamber
Relayinstrumentchamberisusedtoinstallallkindsofomponents,uchasrelays,instrumentssignalindicatorandoerating switch,etc.Inddinitsalabletodsallusambrotetooftisrumentamberaccodingtotmadofte clients,andset16linestocontrol thesmall bus
Pressurereleasingdevice
Onthehandcartchamber,buschamberandcablechamberisinstalldpressurereleasingdevice.Whenthereisinteralfaultarc inthebreakerainsoisideteableambenditteparanceoflectricarctheintealprssreinteitchbet rises.Afteritsestocertainpressure,tepressurereleasingmetalseetoftheopeviceilepenedutomaticallnde pressure and the gasare released to guarantee thesafety ofthe operatorand the switch cabinet.
Latchingdevice
Latchingdeviceisusedtoconnectthecentralexitandcabinetbodyandtheliftingdeviceisalsodesignedtomakeitmore convenienttoopenthecentralexit.Whnthecentralexittaysclosed,theconnectingstrengthwiththecabinetbodyisthetndte capabilityagainst the internal arcing fault effectively isstrengthened.
XGN66-12
High voltage switchgear series
Respectingpromiseandkeepingpromise,operatingintherightway，strivingfor perfection,coexistenceandwin-winsituation
Overview
XGN6-12fixedclosedswitchgear(hereinafterreferedtoasswitchgear)isanewgenerationofhigvoltageelectricalcomplete setsofourcompanyinlinewithationalandardGB3906"3-3kVACmetalenclosedswitchgear"PowerDepartmentD404"door AChighvoltageswitchgearorderTherequirementsofTechnicalConditionsalsomttherequirementsof theintermationalstandard IEC60298 "AC metal-enclosed switchgearand control equipmentbelow 1kVbelow 5 2 \mathsf { k V } ^ { * }
Theproductabsorbs foreignadvanced technology,itssmall size isonly 5 0 % ofthevolume of theordinaryswitchgear;thecircuit breakerhashighreliabiltandgoodperformance;thefive-profinterlockingmechanismiseliableandsimple.Thswithgearis3.6 7.2,12kVthrepseAC5OHzsingebusbarsegmentedindoorunitforreceiviganddistributingelectricalenergyltsthefunctions fcontrolingrotetigdoigtitIansdiioustfoeants,ubstatiosdustradin enterprises,high-risebuildings,etc.,andcanalsobecombinedwith ring networkcabinets foruseinopeningandclosing.
Modelandmeaning
Useenvironmentalconditions
1.The altitude does not exceed 1000m.
2.Ambienttemperature: - 2 5 ^ { \circ } \mathsf { C } ~ + 4 0 ^ { \circ } \mathsf { C } ,theaverage temperaturewithin24 hoursdoesnot exceed + 3 5 ^ { \circ } C 美
3.The horizontal inclination is nomore than3 degrees.
4.The intensity of the earthquakedoesnot exceed8 levels.
5.No severe vibrationand shock and explosion hazard.
Structuralfeatures
1.The cabinet is welded with high quality angle steel.
2.Thecircuitreakerooiscaedintedle(owerpartoftabetichisonentforistalltiocommissgd
maintenance.The standard VS1 circuit breakeris equipped withapressure relief channel to ensure personal safety.
3.Theadvancedandreliablerotaryisolatingswitchcansafelyenterthecircuitbreakerroomformaintenanceunderthemainbus.
4.The whole cabinet protection class IP2X.
5.Witharelablandfullyfunctioalmandatoymechaicallckingdevice,itisayndefectietomeete"fv-proofqient
6. Has a reliable grounding system.
7.Theobservationwindowisinstalledonthedooandtheworkingstateofthecomponentsinthecabinetcanbeclearlyobserved.
8.TheoperatingmechanismislockedwiththeJSXGNlockingmechanismfortheXGN2-22cabinet,whichissimple,reliableand
convenient.
9.The incoming and outgoing cable is lower than the front of the cabinet for easy connection.
Themaintechnicalparameters
| Name | Unit | Data |
| Rated voltage | kV | 3.6，7.2，12 |
| Rated orkingfrequency endurable voltage | kV | To the ground,phase:42: Fracture: 48 |
| Rated lightning impulse withstand voltage | kV | To the ground,phase:75:Fracture: 85 |
| Rated frequency | Hz | 50 |
| Rated current | A | 630，1250, |
| Rated short-circuit breaking current (effective value) | kA | 20，25，31.5, |
| Rated short circuit closing current (peak) | kA | 50，63，80, |
| Rated dynamic current (peak) | kA | 50，63，80 |
| Rated thermal stability current 4s (RMS) | kA | 20，25，31.5 |
| Protection grade | IP2X | |
| The external dimension width X deep X is high | mm | 900×1000×2300 |
| Weight | kg | ~600 |
1.Cabinet door
2. flashlight
3.Observed window
4.Operating mechanism
5.small gate board
6.meter door
7.brow
8. Busbar wall bushing
9.bolt
10.washer
11.washer
12. Nut
13.Isolating switch
14. Pull rod
15.Rear sealing board
16.Current transformer
17.Vacuum circuit breaker
18.Isolating switch
19.transducer
20.bolt
21.washer
22.washer
23.scaffolding
24.Surge arrester
HXGN□-12
High voltage switchgear series
Respectingpromiseandkeepingpromise,operatingintherightway，strivingfor perfection,coexistenceandwin-winsituation
Overview
HXGN□-12(SF6)UnittypeACmetalenclosedringmainunit(hereafterrefertoasringnetcabinet)isanewgenerationof highpressureelectricapplianceproductdesignedanddevelopedindependentlybyourowncompanyaccordingtotherequirementofthe domesticagriculturalelectricityandthecitynettransformationafterintroductionofoverseasadvancedtechnology.Eachtechical performance index completely reaches the IEC298 and GB3906 standard.
Theloop-netcabinetsmainswitch,theoperating mechanismandthecomponentsismadeoftheABBCorporationoriginalpiece ortheSFL-12/24switchequipmentimportedoverseasandass-embledathome.WecanalsoinstallteABBCorporationoriginalpiece ofHAD/UStypeSFaccordingtotherequestofusers.ThecircuitbreakerortheVD4-Svacuumcircuit-breakerdivideintotwokinds:be operatedmanuallyand electricallyaccordingto theoperatingmode.
Thecabinetbodyisrivetedafterprocessedbynumericalcontrolmachinetolwithreliablemechanicalinterlockingandthemis operatingprevention function.TheprotectiongradereachesIP3X.Thisproducthas theremarkablecharacteristicssuchasthesmal volume,lighteghtrtisticppearane,plerationlonglife,ighramteritholtindlitetece.
Useenvironmentalconditions
1.The altitude should not exceed 2000m.
2.Surrounding air temperature: - 2 5 ^ { \circ } C ~ + 4 0 ^ { \circ } C
3.Relative temperature: the daily average value is not higher than 9 5 % ,the the monthly average value is nothigher than 9 0 %
4.Surrounding air without caustic gas or ignitable gas,steamand other obvious pollution
5.Without fierce vibration
Using
HXGN□-12(SF6)unitpeexchangemetalring-netswitchingequipment,issuitabletoexchange5OHz、12K,searvingasdevice of receiving and distribution of electrical energy.
Modelandmeaning
Themaintechnicalparameters
| Item | Unit | Parameters |
| Rated voltage | kV | 12 |
| Rated frequency | Hz | 50 |
| Main bus bar rated current fuse breaker maximum rated current | A | 630/125 |
| Main loop,earthed loopshort timeendurable ratedcurrent | kA/s | 20/3 |
| Main loop,earthed loopmaximumendurableratedcurrent | kA | 50 |
| Main loop,earthed loop short circuit on-and off rated current | kA | 50 |
| the opening number of the load switch with full capacity | 次 | 100 |
| The fused breaker opening thecurrent | kA | 31.5、40 |
| Ratedclosed loopopeningcurrent | A | 630 |
| Ratedshiftcurrent | A | 1600 |
| Machine'life | 次 | 2000 |
| 1min line frequencyresistance (peak value)recurrence,to the earth/isolation fracture | kV | 42/48 |
| The lighting shock resistance (peak value) recurrence,to the earth/isolation fracture | kV | 75/85 |
| Secondary loop 1min line frequency voltage resistance | kV | 2 |
| Protection grade | IP3X |
Structuralfeaturesandworkingprinciple
Theoutinestructureof theproductisreferredtoasdiagram1anddiagram2;theinstalationdimensionisreferredtoasdiagram3. Thisringnetworktypecabinetmakesairasthensulatingmedium,mainlyassembledwithZFN-10/630typevacuumloadswitchAnd thereare two cabinet schemes-incoming cabinet and outgoing cabinet.
1.Incoming cabinet scheme
There isa Z F N \sqsupset - 1 0 / 6 3 0 type vacuum load switch on the main circuit inside the cabinet with isolating knife,and grounding knife condionallyTethreeofthemarealinstalledinonemacinestandndthereareinterlocksamongthem,sothatitisalizedto connectheoperationofthreeworkingstationsofbussolationandgrounding.Isideteabinethecom-ponntssuchasCYre available.
2.Outgoing cabinet scheme
ZFN-10/630type vacuumloadswitch,fusewithstriker(usedasisolatingswitch)and groundingknifeonthe main circuit inside thecabinet,andthethreeworkingstationsoper-ationcanberealized.InsidethecabinethecomponentssuchasCT/PTandZNO arresterareavailable,sothemeteringcabinetcanbeomited.Insidetheincomingcabinetandout-goingcabinet,thereisinsulating protectingbaffeinterlockedwithgroundingswitch.Andinsidethecabinetsthemechanicalinterlocksareadoptedbetweeneach switchandbaflaswellasthecabinetdoorwiththerequirementoffivepreventioandIP2Xofteprotectiodegreeofthecabinet enclosure.
XGN□-12
Fully sealed fully insulated inflatable ring network switchgear
Respectingpromiseandkeepingpromise,operatingintherightway，striving for perfection,coexistenceandwin-winsituation
Overview
XGN□-12seriesfulyinsulatedfullyenclosedringnetworkswitchgearisSF6gasinsulatedmetalcommonboxclosedswitchgear whichcanbeusedbyloadswitchunit,loadswitchfusedcombinationofelectricalunit,vacuumcircuitbreakerunit,buslineunit andothermodules.Usearangeofadvancedtechnologiesandmaterials.Hasexcelentelectricalpropertiesand machineryThe performanceisfctedyviontdateallndmpactsyttal,syratented flexiblecombinationClearandintitivedesignensureseasyoperationdirectFeederwiringcapacityislarge,suitableforaarietyof wiring systems.
Modelandmeaning
Fourcorecompetitiveness
1.Operational safety.Through the following security measures,we can provide users with special security guarantees:
\blacktriangle Integratedthree-station loadswitch
\blacktriangle Circuit breakeradopts load switch instead of isolationswitch,which ismoresafeand reliable
\blacktriangle One-side fully enclosed design provides protection against accidental contact
\blacktriangle Mechanical interlocktomeettherequirementsoffivedefenses
\blacktriangle Electricity display can provide instructions for electrification on the incoming and outgoing lines
2.Reliableoperation.Fullysealeddesign,all1OkVswitchandbus-barchargedbodyaresealedintheairbox weldedwith3mm stainlessteelplate;equippedwithsiliconerubbercableplugtorealizethecableheadEdgesealedsothatitisnotaffctedbydust moisture,small animalsand other external environment:
\blacktriangle Springenergystorage operatingmechanism,canbemanuallyor electricallyoperated \blacktriangle Panel model line diagram providesswitch position indication \blacktriangle Cabinet made of galvanized sheet,electrostatic spraying on the surface to enhance corosion resistance \blacktriangle The pressure gauge monitors the safe pressure range of SF6 gas in the box
3.Economicality.
\blacktriangle Maintenance-free \blacktriangle highlyreliable \blacktriangle Service life up to20 years
4.The program is flexible.
\blacktriangle Avarietyofwaystoenter,canachieve left,right,uporforward line \blacktriangle multiple combinations,any combination between the units canbeachieved \blacktriangle Insulation bus-bars can be used to combine front and back cabinets or cabinets \blacktriangle Flexible design \blacktriangle Optional arrangement of spring mechanism and permanent magnet mechanism
Themaintechnicalparameters
| project | unit | Cmoduleload switchunit | Fmoduleloadswitch-fuse combinationelectricunit | Vmodulebreaker unit | |
| Rated voltage | kV | 12 | 12 | 12 | |
| Rated current | A | 630 | 125Note(1) | 630 | |
| Power frequency withstand voltage/1minute | Phase/phase | kV | 42 | 42 | 42 |
| Fracture | kV | 48 | 48 | 48 | |
| Impact pressure | Phase/phase | kV | 75 | 75 | |
| Fracture | kV | 85 | 1 | 85 | |
| Ratedclosed-loop breaking current | A | 630 | |||
| Ratedcablechargingbreakingcurrent | A | 30 | 1 | ||
| Rated breaking inductive current | A | Note(2) | 1 | ||
| Rated short-timewithstand current /3s | kA | 20 | 1 | 20 | |
| Rated peak withstand current | kA | 50 | 1700 | 50 | |
| Ratedtransfercurrent | A | Note(3) | 1 | ||
| Rated short-circuitbreakingcurrent | kA | ： | 20 | ||
| Rated short-circuitcurrent | kA | 50 | = | ||
| Rated short circuit breaking frequency | second | = | 30 | ||
| Ratedshortcicuiingieadswih | second | 5/5 | = | ||
| Rated current breaking frequency | second | >100 | |||
| Number of mechanical operations (load switch/ groundingswitch) | second | 5000/2000 | 5000/2000 | 30000 | |
Non-extendedstandardmodules
A total of the following15 standard combinations
Each module of XGN0-12 non-expansion standard modular unit cabinets has the following configuration Dcabineta liftingmodule
Standard Configuration and Features of "Cable Connection Module without Grounding Knife"
\spadesuit \mathsfit { C } cabinet one load switch touch block
Standard Configurationand Characteristicsin "Load Switch Modular Block"
\spadesuit F cabinet-load switch fuse assembly cross section
"Standard Configuration and Features of Load Switch Fuse Combination Module"
\blacktriangle V cabinet vacuum switch cross piece
Standard Configuration and Features in "Vacuum Switch Module"
\blacktriangle CapacitiveVoltage Indicatorfor InletSleeve
\blacktriangle Install a pressure gauge formonitoringSF6 density ineachairchamber
\blacktriangle lifting lug
\blacktriangle Operation handle
\blacktriangle Optional
Electric operating mechanism
Cable short circuit and ground fault indicator
Current transformersandmeters
Remotemonitoringand connection
XGN□-40.5
Totally enclosed and fully insulated inflatable ring network switching equipment
Respectingpromiseandkeepingpromise,operatingintherightway，striving for perfection,coexistenceandwin-winsituation
Overview
XGN-40.5fullyenclosedandfullinsuatedinflatableringnetworkswitchgearprovides10standardcombinations,whichcameet theapplicationrequirementsof most 3 6 ~ 4 0 . 5 \mathsf { k V } distribution networks.LPC-40.5 isa compact open close cabinet,which can provide almost anycombination of the selected functional units.
XGN-40.5fullyenclosedandfullyinsulated inflatablering network switchgearhas interfaceanduserinterface,providinga completeswitchingapplicationsolutionin 3 6 ~ 4 0 . 5 \mathsf { k V } secondarydistribution network.
Thestainless steelgaschamberofXGNO-40.5fullyenclosedand insulated inflatableringnetworkswitchgearisflledwith SF6 gas,which completely sealsall live partsand switches from the outside.
Thenternalsihndlliveartsreotffctedyehangsoftextaenvironntsuinggelabilityel safetyand practicallymaintenance free.
Placeofuse
compact secondary substation
small industrialandmining enterprises
wind power plant
hotels,shopping mals,ofice buildings,business centers,etc
C- load switch unit
D-direct cable connection unit
De- direct cable connection unit with grounding switch
F-load switch fuse combination unit
V-vacuumcircuit breakerunit
LPC-40.5application
XGN□-40.5 compact switchgear,fully modular design,typical configuration
